PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj5g3v2297810.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family BES1
Protein Properties Length: 319aa    MW: 34519.3 Da    PI: 9.3786
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj5g3v2297810.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822203.46.5e-63111422130
           DUF822   2 gsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpl...eeaeaagssasaspes 92 
                      +++rkp+w+ErEnn+rRERrRRaiaakiy+GLRaqGny+lpk++DnneVlkALc+eAGw+ve+DGttyrkgs+      + + ag+s++++p s
  Lj5g3v2297810.1  11 TNRRKPSWRERENNRRRERRRRAIAAKIYTGLRAQGNYNLPKHCDNNEVLKALCAEAGWTVEEDGTTYRKGSNAAaggGAGDGAGTSTRNTPFS 104
                      689**********************************************************************99998999************* PP

           DUF822  93 slqsslkssalaspvesysaspksssfpspssldsisl 130
                      s++ s+ ss+++sp++sy+ sp+sssfpsps+ld  +l
  Lj5g3v2297810.1 105 SQNPSPLSSSFPSPIPSYQVSPTSSSFPSPSRLDASNL 142
                      *********************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056871.6E-5912140IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009742Biological Processbrassinosteroid mediated signaling pathway
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048316Biological Processseed development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MPSDGATSAA TNRRKPSWRE RENNRRRERR RRAIAAKIYT GLRAQGNYNL PKHCDNNEVL  60
KALCAEAGWT VEEDGTTYRK GSNAAAGGGA GDGAGTSTRN TPFSSQNPSP LSSSFPSPIP  120
SYQVSPTSSS FPSPSRLDAS NLYPYMRNVF PASLPPLRIS NSAPVTPPLS SPTSRNNPKP  180
IPTWDSIAKA SMAAASFNHP LFAASAPASP SHRHLYTPPT IPECDESDSS TVESGQWLNF  240
QAFAPFAPSP PSGMQMSPTF NFIKPVMRQQ QNMPDSRDQE MRSSEADFGV QVKPWVGERI  300
HEVGLDDLEL TLGSGKAPS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11231RRKPSWRERENNRRRERRRR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.61500.0floral bud| flower| pod| protoplast| root
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00237DAPTransfer from AT1G75080Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0096760.0AP009676.1 Lotus japonicus genomic DNA, clone: LjT30I08, TM0492, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003528182.11e-149PREDICTED: protein BRASSINAZOLE-RESISTANT 1-like
SwissprotQ8S3071e-118BZR1_ARATH; Protein BRASSINAZOLE-RESISTANT 1
TrEMBLI1K7U01e-148I1K7U0_SOYBN; Uncharacterized protein
STRINGGLYMA06G03700.11e-148(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127534105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75080.28e-89BES1 family protein